PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G085400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 366aa    MW: 38996.6 Da    PI: 6.6925
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G085400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-173178148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Sevir.5G085400.1.p 31 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 78
                        89********************************************97 PP

2Myb_DNA-binding52.41.3e-1685127246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Sevir.5G085400.1.p  85 GNLTPEEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 127
                         678******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8852678IPR017930Myb domain
SuperFamilySSF466894.87E-3128125IPR009057Homeodomain-like
SMARTSM007171.2E-133080IPR001005SANT/Myb domain
PfamPF002496.3E-153178IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-223285IPR009057Homeodomain-like
CDDcd001671.65E-113378No hitNo description
PROSITE profilePS5129425.02779133IPR017930Myb domain
SMARTSM007175.1E-1583131IPR001005SANT/Myb domain
PfamPF002491.6E-1585127IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2386132IPR009057Homeodomain-like
CDDcd001674.38E-1388127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MQATIMSQRK GAAMAAVATS KHEEEMMELR RGPWTLEEDN LLMNYIACHG EGRWNLLARC  60
SGLKRTGKSC RLRWLNYLKP DIKSGNLTPE EQLLILELHS KWGNRWSRIA QHLPGRTDNE  120
IKNYWRTRVQ KQARQLRVDA NSAVFRDAVR CYWMPRLLEK MAAATATSAH QVDPALLHPA  180
AHIAGGMASA DASSPVHVGG HQDAATNAPG SGGYGHHGPQ RYPVDPSPST STSGGSGSTS  240
AAALPPVPCF SELSWVDQYS PYADLDGGAF DAAALGGLGL DGLDLGPADS DFYSDSTLLD  300
YLNSTCCTGG GAMMTTMMSG VNAAHSSCGG AMGGQDGDYG SSWRADDICQ AAARKLGDHQ  360
WGGGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-27281321104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794270.0HF679427.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB21 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968076.10.0PREDICTED: trichome differentiation protein GL1-like
TrEMBLK3XPP40.0K3XPP4_SETIT; Uncharacterized protein
STRINGSi003873m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-80myb domain protein 62